SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q95RZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q95RZ8
Domain Number 1 Region: 144-192,369-442
Classification Level Classification E-value
Superfamily SET domain 1.64e-18
Family Viral histone H3 Lysine 27 Methyltransferase 0.027
Further Details:      
 
Domain Number 2 Region: 18-98,498-536
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000607
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 3 Region: 184-233
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000126
Family MYND zinc finger 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q95RZ8
Sequence length 567
Comment (tr|Q95RZ8|Q95RZ8_DROME) HL04910p {ECO:0000313|EMBL:AAL28571.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7759 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MMLYTRSYVALPSENVAEIRVVLANRSATLYHMQKYQECLIDIKRALDLSYSKDLIYKLY
ERQARCYMALKDYPHTIDSFKKCITAMDDSTLASDKRAKLNLDAMTMIKMLQNDPRTAKQ
EAKQQKQKIALDQAKPVKLENEFVSPLVRIDSNRQEGRFARASADVKPGEELLVERPFVS
VLLEKFAKTHCENCFMRTVVPVACPRCADVLYCSEQCREEASKKYHKYECGIVPIIWRSG
ASINNHIALRIIASKPLDYFLKLKPTIDEELTPEQLISLPKDDFRRVAQLERHQGERQPS
NFFQHVLMARFLTNCLRAGGYFGSEPKPDEVSIICSLVLRSLQFIQFNTHEVAELHKFSS
SGREKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVRPIEAGLPINENYGPMYT
QDERSERQARLKDLYWFECSCDACIDNWPKFDDLPRDVIRFRCDAPNNCSAVIEVPPSCN
DFMVKCVTCGEITNILKGLKVMQDTEMMTRTAKRLYETGEYPKALAKFVDLIRIMYEVLA
PPFPDFCESQQHLKDCFLNLGNVYTLD
Download sequence
Identical sequences Q95RZ8
FBpp0087233 FBpp0087233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]