SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q95T46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q95T46
Domain Number 1 Region: 145-247
Classification Level Classification E-value
Superfamily Bromodomain 2.75e-36
Family Bromodomain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q95T46
Sequence length 249
Comment (tr|Q95T46|Q95T46_DROME) Toutatis, isoform B {ECO:0000313|EMBL:AAM68713.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG10897 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPGVYPVYTPVAAGNFSAGLINQAPVQPAMPFANVVAMSPRAVTPTRTRTPTPTPAPTPP
PPPPTPLLMQASPTATALHVNACQSPPQQQHAQLMTMPSPPAIGVGTATNQMSPPPINIH
AIQEAKEKLKQEKKEKHATKKLMKELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKI
IKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESR
WGELTDKHS
Download sequence
Identical sequences Q95T46
NP_725062.2.81976 FBpp0087196 FBpp0087196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]