SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q95VT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q95VT1
Domain Number 1 Region: 411-721
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.23e-68
Family Duffy binding domain 0.00000000000506
Further Details:      
 
Domain Number 2 Region: 134-406
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.1e-55
Family Duffy binding domain 0.0000000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q95VT1
Sequence length 1402
Comment (tr|Q95VT1|Q95VT1_PLAFA) Erythrocyte-binding antigen-175 {ECO:0000313|EMBL:AAK96216.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=EBA-175 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
KARNEYDIKENEKFLDVYKEKFNELDKKKYGNVQKTDKKIFTFIENKLDILNNSKFNKRW
KSYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLSTSSLIKQNKYVPINAVRVSRILSFLD
SRINNGRNTSSNNEVLSNCREKRKGMKWDCKKKNDRSNYVCIPDRRIQLCIVNLSIIKTY
TKETMKDHFIEASKKESQLLLKKNDNKYNSKFCNDLKNSFLDYGHLAMGNDMDFGGYSTK
AENKIQEVFKGAHGEISEHKIKNFRKEWWNEFREKLWEAMLSEHKNNINNCKNIPQEELQ
ITQWIKEWHGEFLLERDNRSKLPKSKCKNNTLYEACEKECIDPCMKYRDWIIRSKFEWHT
LSKEYETQKVPKENAENYLIKISENKNDAKVSLLLNNCDAEYSKYCDCKHTTTLVKSVLN
GNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTKVWECKKPYKLSTKDVCVPPRRQELCLG
NIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDKEVCKIINKTFADIRDIIGGTDY
WNDLSNRKLVGKINTNSNYVHRNKQNDKLFRDEWWKVIKKDVWNVISWVFKDKTVCKEDD
IENIPQFFRWFSEWGDDYCQDKTKMIETLKVECKEKPCEDDNCKRKCNSYKEWISKKKEE
YNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKKYSEKCSNLNFEDEFKEELHSDYKNKC
TMCPEVKDVPISIIRNNEQTSQEAVPEESTEIAHRTETRTDERKNQEPANKDLKNPQQSV
GENGTKDLLQEDLGGSRSEDEVTQEFGVNHGIPKGEDQTLGKSDAIPNIGEPETGISTTE
ESRHEEGHNKQALSTSVDEPELSDTLQLHEDTKENDKLPLESSTITSPTESGSSDTEETP
SISEAPKGNEQKKRDDDSLSKISVSPENSRPETDAKDTSNLLKLKGDVDISMPKAVIGSS
PNDNINVTEQGDNISGVNSKPLSDDVRPDKNHEEVKEHTSNSDNVQQSGGIVNMNVEKEL
KDTLENPSSSLDEGKAHEVLSEPNLSSDQDMSNTPGPLDNTSEETTERISNNEYKVNERE
DERTLTKEYEDIVLKSHMNRESDDGELYDENSDLSTVNDESEDAEAKMKGNDTSEMSHNS
SQHIESDQQKNDMKTVGDLGTTHVQNEISVPVTGEIDEKLRESKESKIHKAEEERLSHTD
IHKINPEDRNSNTLHLKDIRNEENERHLTNQNINISQERDLQKHGFHTMNNLHGDGVSER
SQINHSHHGNRQDRGGNSGNVLNMRSNNNNFNNIPSRYNLYDKKLDLDLYENRNDSTTKE
LIKKLAEINKCENEISVKYCDHMIHEEIPLKTCTKEKTRNLCCAVSDYCMSYFTYDSEEY
YNCTKREFDDPSYTCFRKEAFS
Download sequence
Identical sequences Q95VT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]