SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q95W37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q95W37
Domain Number 1 Region: 240-287
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q95W37
Sequence length 348
Comment (tr|Q95W37|Q95W37_PLABE) Thrombospondin-related protein 3 {ECO:0000313|EMBL:AAL30460.1} KW=Complete proteome; Reference proteome OX=5821 OS=Plasmodium berghei. GN=PBK173_000461400 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MIKMGRFSIILISFFLTLHQEILGKIDTKKNEDPVVQLLQATQNYKVVVLEPECFINSKT
PKLMNSSNYKDEENFDRKEFLMYNYIVINNYEFSNAKSLEIYSSKEKNITNYLILTFYIE
GLSFLVNKNFIYDIFLHLSTAGDNKKMECTNKYYDVSLLKSIDVLSPSELEILSDPIKFT
MGTESGSFRINITQMFMNDTWKAFIKNKISFLIKPEEDCYVLLEDKLNKPTLVIEKMSSF
YTEWGEWSQCTMECNHPDNVQIRERRCIHPNGDCFKGDLKESRPCNVPLPPCYSLFENKD
SSKLKITIVAFPIIIVICVFIILYRIFYSKKSTEKELYENVAGRFMYE
Download sequence
Identical sequences A0A077XK87 Q95W37
PBANKA_143360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]