SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q95XT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q95XT8
Domain Number 1 Region: 112-345
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.26e-26
Family Nuclear receptor ligand-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q95XT8
Sequence length 357
Comment (tr|Q95XT8|Q95XT8_CAEEL) Uncharacterized protein {ECO:0000313|EMBL:CCD73141.2} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_Y67D8B.2 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MFNEFLYKVEQMEEDDGEQRAKSDKAGDQRMAIYVNHSFQVSQGDRYRFPSNQFGYGLSN
CSPYFLQDFTHVLNRYMQLEAYCDAVDDLTGALPKTGLAPNEPDLFQALFFPRSIAPRTP
MNPVASTQMTEETLSAMWFRLVAHYFEWLAGISELQYLSDQDKLRLAVCQLCKVVCFSVV
YANYHFKNDENDDLLFFGSGFYWDPARGNDPLMDDYCQEMKRIVNQVVYPLRKVGMVKEE
FVLVKLILLFDCTSLMGLSDEGLEFTRSMCNKYRTTLSQYVRCHIEELADTEGWSQNEID
RCSMDRIKNLLDLPIGVEKLGKLDDDSLAEMVESNYGGMRGTLQQQIHTESRKVRNR
Download sequence
Identical sequences Q95XT8
NP_500299.2.50509 Y67D8B.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]