SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q966B9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q966B9
Domain Number 1 Region: 94-324
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-25
Family Nuclear receptor ligand-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q966B9
Sequence length 326
Comment (tr|Q966B9|Q966B9_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CCD69584.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_Y46H3D.5 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSPENIQYDRDKFESILKSSKNNRHLQIPNTVESQLCISPLVSFSNRREKSSKCIDISQI
VKKAVAKLLNPAMIRNIDSTSNLEQLTSGFKNLQSGQKENIPKIDHITLAHQTQHFNSSM
CSAAVWLGYSDRFKTYSDMQKIKVLQAIWCIWGRLEGIVMTAKMRIIGKCEKEQFFLTSD
TLIVYDNFSSDLDYCSTYPFEEMKYFFIPREMFHEDVISELVKVQPDDVETTYLMSVVCL
QLTGKRYGGLIQEEMEQFQDILSNDLHEYYINNKMPKYLLRIKQLMRVKEMFLRNLNIRM
EKYKIAGVFNVFNRPISNLEFFTVPI
Download sequence
Identical sequences Q966B9
NP_001041194.1.50509 Y46H3D.5a.1 Y46H3D.5a.2 Y46H3D.5a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]