SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q96L92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96L92
Domain Number 1 Region: 154-270
Classification Level Classification E-value
Superfamily PX domain 1.83e-25
Family PX domain 0.0018
Further Details:      
 
Domain Number 2 Region: 39-137
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-24
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 3 Region: 274-341
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000185
Family Ubiquitin-related 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96L92
Sequence length 541
Comment (sp|Q96L92|SNX27_HUMAN) Sorting nexin-27 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SNX27; OC=Catarrhini; Hominidae; Homo.
Sequence
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQ
VSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNHVNVEGATHKQVVDL
IRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPRYKHVEQNGEKF
VVYNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLE
EYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDGTTVTVRVKKNSTTDQV
YQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRT
CEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTD
EEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQMARSQQRDVA
T
Download sequence
Identical sequences A0A2J8JJN4 Q96L92
ENSGGOP00000028633 ENSP00000400333 XP_003949594.1.37143 XP_004026699.2.27298 XP_005245566.1.92137 ENSP00000357834 ENSGGOP00000028633 9598.ENSPTRP00000051777 ENSP00000400333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]