SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q96MN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96MN2
Domain Number 1 Region: 549-980
Classification Level Classification E-value
Superfamily RNI-like 1.18e-79
Family 28-residue LRR 0.000011
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily DEATH domain 4.36e-32
Family Pyrin domain, PYD 0.0032
Further Details:      
 
Domain Number 3 Region: 112-236,270-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000108
Family Extended AAA-ATPase domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q96MN2
Sequence length 994
Comment (sp|Q96MN2|NALP4_HUMAN) Ribonuclease inhibitor 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NLRP4; OC=Catarrhini; Hominidae; Homo.
Sequence
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIH
LYFEEEVKQEECDHLDRLFAPKEAGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRD
RFLYTFYFCCRELRELPPTSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGGL
NEPDSDLCGDLMEKRPVQVLLSSLLRKKMLPEASLLIAIKPVCPKELRDQVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LALTCQSTTSVYSSFVFNLFTPEGAEGPTPQTQHQLKALCSLAAEGMWTDTFEFCEDDLR
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCV
QELLVANFEKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQIHQCLKSLGE
RGNPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLR
KLCFSVQNVFKKEDEHSSTSDYSLICWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCN
QLRHPSCRLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNY
PAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTV
LVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDS
LCLVKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGL
EECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEALRHPECALQVLGLRKT
DFDEETQALLTAEEERNPNLTITDDCDTITRVEI
Download sequence
Identical sequences Q96MN2
ENSP00000301295 ENSP00000301295 gi|194018482|ref|NP_604393.2| 9606.ENSP00000301295 ENSP00000301295 NP_604393.2.87134 NP_604393.2.92137 HR3421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]