SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q970H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q970H8
Domain Number 1 Region: 1-65,137-314
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 8.72e-74
Family Pyruvate kinase 0.0000273
Further Details:      
 
Domain Number 2 Region: 299-436
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 8.5e-27
Family Pyruvate kinase, C-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 61-147
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.00000000000000227
Family Pyruvate kinase beta-barrel domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q970H8
Sequence length 438
Comment (tr|Q970H8|Q970H8_SULTO) Pyruvate kinase {ECO:0000256|RuleBase:RU000504} KW=Complete proteome; Reference proteome OX=273063 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7). GN=STK_16170 OC=Sulfolobus.
Sequence
MFRKTKIIATLGPSSENHIDELVKYVDVIRLNFAHGDKEQHEKYFNLVKNRVPILVDLPG
PKLRIGDLGKNMILLKPGDTIEFGTQIPVDDILFFKLIRKGSEVLISDGRIRVKIIEAGN
NYAKGLVEEGGILTSRKGINIPDSEIPVGLTDRDLELLKYALEMGATFIGLSFVTSPEEI
RKAKEIVKDQAWIIAKIEKKSALKKLKEIIREADGVMVARGDLGVEVGLANLPQTQRRIV
RLTRLYGKPVILATQVLESMVTSPIPTRAEVIDVANSIIQGVDAIMLSDETAMGQYPIDA
VRTLHELILSVERSFKPRPPPPLKNIDDAIAYSAVSASNLASSSGIVVYTRTGASALRIS
RLRPVVPIIVLTQNQRVYERLKLCYGIYSFISEELNSLDNIVEKSKNIARQVGLKNTIII
IAGGIEEGSTRFLKVEEI
Download sequence
Identical sequences Q970H8
WP_010979673.1.60790 273063.ST1617 gi|15921917|ref|NP_377586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]