SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q973J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q973J5
Domain Number 1 Region: 494-562
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000147
Family Transglutaminase, two C-terminal domains 0.0057
Further Details:      
 
Weak hits

Sequence:  Q973J5
Domain Number - Region: 605-671
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00497
Family Transglutaminase, two C-terminal domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q973J5
Sequence length 869
Comment (tr|Q973J5|Q973J5_SULTO) Uncharacterized protein {ECO:0000313|EMBL:BAB65917.1} KW=Complete proteome; Reference proteome OX=273063 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7). GN=STK_09030 OC=Sulfolobus.
Sequence
MKRLSLLLVLFLLISPLLSLALPTTSTNFSATAQWEVTPPYNVAPGETLVPAQVTLTYNG
EFTLYNVIIKPYNFPAISPFTSNTTYEISKIEPGQQLSLVFLVNISPSIPLGVYNFYISI
YNSSIVFPDCVVSAQLPVLGYVNLYATAQASGILFPGERDVPIDITIYDTGSVSATDVTL
FLNSSYPIQFVTKEVKVPEISTTTPATVQVLANVYSNATVGTYQLKLTALVFGTLYKSLN
VSVSINSNQTVEGKLLNPSVIDDIGSYQDNVPINLQLEYTGPVEINSYSIIITLPQGFTN
ESGGNEIIINGGSVQPNEIIPLTFSLNTKNINLTSYTFPIKIIWNAVEGEGEIVSVVQYI
SFTLIAMGNNEIQITPLTSILYSNSINNVTILLTNQGSGNIYNVTLSVSSPQASILSYKS
QIPEIKAGQSVSIPIELFIPEALQGNSLSITISLNYLNSMYEESQYSQELGFYVASKNYV
PILISLNPPILSPGEFQSTQLILQNTLNTTLYNVSISLSSQGIYLNNTVFEIHTISPHGN
YTVPIELFSSSPGTYTLTVSVSYFDSLVQNSEELNIPIYFSQLNAPSVPILLTLNYTVLT
YDILQNAKLLITNTLNEPIYNVTISLSSQGEIYVNNTIITLPELKPLETLSIPIKVYVGT
TGIVSISASMSYYISGQQKESEELINSLAAGSVDLVVTSVTTLNVGTIISVTGTIYNFGT
GSANGLTVIAEPTRGLQVVGQNTYYVGNLGPDTSSTFTFAFRILNVTAFNRTAFNGFSDP
SSFTRSFANFTGRVFLVPIEFVYTNDIGQVIHTYSNITIHVTNSSEAFTTLTFHSTTTHG
RFFTLIGILILVVIVIVVVVLVLRRRRKE
Download sequence
Identical sequences Q973J5
WP_010978900.1.60790 gi|15921139|ref|NP_376808.1| 273063.ST0903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]