SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q974Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q974Y2
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000175
Family GHMP Kinase, N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q974Y2
Sequence length 249
Comment (tr|Q974Y2|Q974Y2_SULTO) Uncharacterized protein {ECO:0000313|EMBL:BAB65525.1} KW=Complete proteome; Reference proteome OX=273063 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7). GN=STK_05300 OC=Sulfolobus.
Sequence
MTDIEIIVPLNISGIWYPVYTEDIRYTGSIGLSLVLNPPIIAFPKKGEPEIYFNNQRVNF
PNLKYLSLLANVKLYIQSEVPLGFGYGLSGAISLAYALASYELYNIKLEDALVVAHESEI
FTNNGLGDLISEYYGGGLVYRKKPGAPGYGEVEKIIVEWEPICSKPLSKESTEKLIKNKN
DNALVYINQFLHNPSLLKFFDLSRKFTEEIGFISPFPNSFRKKGLILRLKECEEGWIKHT
PAIHGAYIR
Download sequence
Identical sequences Q974Y2
273063.ST0530 WP_010978508.1.60790 gi|15920747|ref|NP_376416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]