SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q97JH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q97JH9
Domain Number - Region: 91-175
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0607
Family BAR domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q97JH9
Sequence length 252
Comment (tr|Q97JH9|Q97JH9_CLOAB) Uncharacterized conserved protein, predicted metal-binding {ECO:0000313|EMBL:AAK79275.1} KW=Complete proteome; Reference proteome OX=272562 OS=5710 / VKM B-1787). GN=CA_C1304 OC=Clostridium.
Sequence
MNNNVELAYLIQENYDLIKESKKILRDGSYIYLLKKLKSEFETAKKNYVNRKTELAKIKQ
SYSAISIELRKEREKMETNEYKLYNKAGSNLNMIEKLEGAIEIEKQNLKNLEDEAVDLLD
EEEKLKKEIEDLRLKLVNIKDNFYDYKEKSSEKVEKARQEMIAAKTKIEEIKSKIPKELF
EEISHLMSKSSCAVAKLNGEICGGCRMKVSSMTIDDLINNNSIVHCDNCGRILYYDESEG
KIKRKYKRKIRA
Download sequence
Identical sequences Q97JH9
gi|384458029|ref|YP_005670449.1| gi|15894586|ref|NP_347935.1| gi|337736522|ref|YP_004635969.1| NP_347935.1.94244 WP_010964616.1.17575 WP_010964616.1.17905 WP_010964616.1.48544 WP_010964616.1.57811 WP_010964616.1.71350 WP_010964616.1.92914 272562.CA_C1304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]