SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q97ZR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q97ZR7
Domain Number 1 Region: 54-103
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000818
Family YlxM/p13-like 0.082
Further Details:      
 
Weak hits

Sequence:  Q97ZR7
Domain Number - Region: 39-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00597
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q97ZR7
Sequence length 269
Comment (tr|Q97ZR7|Q97ZR7_SULSO) Second ORF in transposon ISC1173 {ECO:0000313|EMBL:AAK40832.1} KW=Complete proteome; Reference proteome OX=273057 OS=P2). GN=SSO0511 OC=Sulfolobus.
Sequence
MVIPKLKALILKSFYGPLELPGFSDKCYSDRVIKNGSSRGKSKYKCKVCGRTFYRTASHR
MSREQRERILREYTNRMSLRGISKVEGRPLTTVYSSVKRAALKAYVDLSILQAQLKAFRS
KFAVLDESWTYVRVRRGPRRQNLWIWNALIDGVPFFVTGDRDYNTFRLLWLSLPKCEVHY
TDDYPIYQVLYHHVVGKKYTHTVESYNSFCRSHLVRLARDTKAVNRSRAMIDYSLDLLNV
MYPQAFTDEKTPLNLAYLSGVQYIRDHLI
Download sequence
Identical sequences A0A157SY68 Q97ZR7
gi|15897437|ref|NP_342042.1| 273057.SSO0511 SsR32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]