SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q98FZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q98FZ4
Domain Number 1 Region: 19-239
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.08e-28
Family Dienelactone hydrolase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q98FZ4
Sequence length 244
Comment (tr|Q98FZ4|Q98FZ4_RHILO) Mll3556 protein {ECO:0000313|EMBL:BAB50422.1} KW=Complete proteome; Reference proteome OX=266835 OS=Rhizobium loti (strain MAFF303099) (Mesorhizobium loti). GN=mll3556 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MSETASGLSATPGQPLVYRDDGTDFSGRIVMPDGAVRGSLVYVPDWYGIYDYTLAEARRF
ASLGFAVMVADVYGAGVRITSDAQATQASQFLRDNPRTASRRLQAGVRAFRDVVPQAPFL
AAVGFSLGGFCVLEMLTDAPLVRGAVILSGALGQPAGDYAAIETPIRFHHGTRDMVADVA
RVTKVLAWLEAKGCDCALTLYAGARHAFTNPNLPSGGDGWLGYDARYAGEADAATESFLL
SLKG
Download sequence
Identical sequences Q98FZ4
266835.mll3556 gi|13473069|ref|NP_104636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]