SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q99518 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99518
Domain Number 1 Region: 3-241
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.22e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0024
Further Details:      
 
Domain Number 2 Region: 311-455
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000751
Family FAD/NAD-linked reductases, N-terminal and central domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q99518
Sequence length 471
Comment (sp|Q99518|FMO2_HUMAN) Pulmonary flavin-containing monooxygenase 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FMO2; OC=Catarrhini; Hominidae; Homo.
Sequence
MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVT
NTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCPDFS
SSGQWKVVTQSNGKEQSAVFDAVMVCSGHHILPHIPLKSFPGMERFKGQYFHSRQYKHPD
GFEGKRILVIGMGNSGSDIAVELSKNAAQVFISTRHGTWVMSRISEDGYPWDSVFHTRFR
SMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMKEPVLNDDVPSRLLCGAIKVK
STVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMVSLYKYIFPAH
LDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLF
GESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCNSY
Download sequence
Identical sequences Q99518
ENSP00000209929 gi|4503757|ref|NP_001451.1| 9606.ENSP00000209929 ENSP00000209929 ENSP00000405905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]