SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q99929 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99929
Domain Number 1 Region: 54-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.5e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q99929
Sequence length 193
Comment (sp|Q99929|ASCL2_HUMAN) Mash2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ASCL2; OC=Catarrhini; Hominidae; Homo.
Sequence
MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERER
NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
RPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAE
RELLDFSSWLGGY
Download sequence
Identical sequences Q99929
ENSP00000332293 gi|4885665|ref|NP_005161.1| ENSP00000332293 ENSP00000332293 HR4510 9606.ENSP00000332293 NP_005161.1.87134 NP_005161.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]