SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q99K30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99K30
Domain Number 1 Region: 47-174
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-49
Family Phosphotyrosine-binding domain (PTB) 0.0000688
Further Details:      
 
Domain Number 2 Region: 497-574
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-16
Family SH3-domain 0.00022
Further Details:      
 
Weak hits

Sequence:  Q99K30
Domain Number - Region: 633-692
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000161
Family SAM (sterile alpha motif) domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q99K30
Sequence length 729
Comment (sp|Q99K30|ES8L2_MOUSE) Epidermal growth factor receptor pathway substrate 8-related protein 2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Eps8l2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSQSASMSCCPGAANGSLGRSDGVPRMSAKDLFEQRKKYSNSNVIMHETSQYHVQHLATF
IMDKSEAIASVDDAIRKLVQLSSKEKVWAQEVLLQVNDKSLRLLDVESQEELENFPLPTV
QHSQTVLNQLRYPSVLLLVCQDSDQNKPDIHFFHCDEVEAELVQEDIESALADYRLGKKM
RPQTLKGHQEKIRQRQSILPPPQSPAPIPFQRQPGDSPQAKNRVGLPLPVPFSEPGYRRR
ESQDEEPRAVLAQRIEKETQILNCTLDDIEWFVARLQKAAEAFKQLNQRKKGKKKNKKGP
AEGVLTLRARPPSEGEFVDCFQKTKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIINT
CGSPDIARSVSSPLLSTDAVSFLRGHLVPKEMTLWESLGETWMRPRSEWPREPQVPLYVP
KFRSGWEPPLDVLQEAPWEVEGLASVPSDQLTPKNRLSVRHSPKHSLSSESQAPEDIAPP
GSSPHANRGYQPTPAMTKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRNRSGQ
AGYVPCNILAEARQEDVGAPLEQSGQKYWGPASPTHKLPPIFAGNKEELIHHMDEVNDEL
MKKISHIKTQPQRNFRVERSQPVHLPLTFESGPDEVRAWLEAKAFSARIVENLGILTGPQ
LFSLNKEELKKVCGEEGSRVYSQLTVQKAFLEKQQSGSELEKLMSKIRRAEDSYTSQHTS
PESEGAPHL
Download sequence
Identical sequences Q99K30
ENSMUSP00000026577 ENSMUSP00000026577 NP_573454.2.92730 ENSMUSP00000026577 10090.ENSMUSP00000026577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]