SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9AJA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9AJA7
Domain Number 1 Region: 8-305
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.54e-27
Family Thioesterases 0.00000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9AJA7
Sequence length 308
Comment (sp|Q9AJA7|LUXD_SHEHA) Myristoyl-ACP-specific thioesterase {ECO:0000255|HAMAP-Rule:MF_00774} OX=25 OS=Shewanella hanedai (Alteromonas hanedai). GN=luxD OC=Shewanellaceae; Shewanella.
Sequence
MECSNSCLTIDHVIQLDDDKEIRVWETLPKDNTAVRNNTILIASGFARRMDHFAGLAEYL
SSNGFHVIRYDSLHHVGLSSGDINEFTMSIGKDSLLIVIEWLKGRGVNKLGLIAASLSAR
IAYEISNDVDLSFLVTAVGVVNLRDTLERSLKYDYLQLEIEDLPEDLDFEGHNLGSKVFV
RDCFKHNWVTLDSTKNKMKNLDIPFIAFTANDDDWVKKAEVLEMMNSISSTKCKLYSLIG
SSHDLGENLVVLRNFYQSVTKAAISLDNDSVDLNVEIFEPKFEELTSVTVQERRLKNKIE
SEILELMN
Download sequence
Identical sequences A0ZSH2 Q9AJA7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]