SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9BRJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BRJ9
Domain Number 1 Region: 81-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000123
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9BRJ9
Sequence length 268
Comment (sp|Q9BRJ9|MESP1_HUMAN) Class C basic helix-loop-helix protein 5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MESP1; OC=Catarrhini; Hominidae; Homo.
Sequence
MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGT
LRDPRAPSVGRRGARSSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSL
TKIETLRLAIRYIGHLSAVLGLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQA
EGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPS
PLLPGDVLALLETWMPLSPLEWLPEEPK
Download sequence
Identical sequences Q9BRJ9
9606.ENSP00000300057 ENSP00000300057 gi|14149724|ref|NP_061140.1| NP_061140.1.87134 NP_061140.1.92137 ENSP00000300057 ENSP00000300057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]