SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9BT23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BT23
Domain Number 1 Region: 67-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000421
Family LIM domain 0.00074
Further Details:      
 
Domain Number 2 Region: 33-65
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000048
Family LIM domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9BT23
Sequence length 127
Comment (sp|Q9BT23|LIMD2_HUMAN) LIM domain-containing protein 2 {ECO:0000305} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LIMD2 OC=Catarrhini; Hominidae; Homo.
Sequence
MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIF
HNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEV
DPGTKTA
Download sequence
Identical sequences A0A0D9QV51 A0A140VJN0 A0A2I3GE42 A0A2J8UZI7 A0A2K5U155 F7AIA7 H2QDN1 Q9BT23
NP_001247518.1.72884 NP_085053.1.87134 NP_085053.1.92137 XP_003270736.1.23891 XP_003270737.1.23891 XP_003270739.1.23891 XP_003811398.1.60992 XP_004091414.1.23891 XP_004091415.1.23891 XP_005257760.1.92137 XP_005257762.1.92137 XP_006722187.1.92137 XP_008010342.1.81039 XP_008010343.1.81039 XP_008010345.1.81039 XP_008010346.1.81039 XP_016788217.1.37143 XP_016788219.1.37143 XP_016788221.1.37143 XP_016788222.1.37143 XP_016788223.1.37143 XP_016788224.1.37143 ENSP00000259006 ENSP00000462707 ENSP00000464003 gi|13386490|ref|NP_085053.1| 9544.ENSMMUP00000022025 9606.ENSP00000259006 ENSP00000259006 ENSMMUP00000022023 ENSP00000259006 ENSP00000462707 ENSP00000464003 ENSNLEP00000005346 ENSMMUP00000022023 ENSMMUP00000022025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]