SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9BUN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9BUN1
Domain Number - Region: 205-253
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0602
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9BUN1
Sequence length 341
Comment (sp|Q9BUN1|MENT_HUMAN) Methylated in normal thymocytes protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MENT; OC=Catarrhini; Hominidae; Homo.
Sequence
MVPAAGALLWVLLLNLGPRAAGAQGLTQTPTEMQRVSLRFGGPMTRSYRSTARTGLPRKT
RIILEDENDAMADADRLAGPAAAELLAATVSTGFSRSSAINEEDGSSEEGVVINAGKDST
SRELPSATPNTAGSSSTRFIANSQEPEIRLTSSLPRSPGRSTEDLPGSQATLSQWSTPGS
TPSRWPSPSPTAMPSPEDLRLVLMPWGPWHCHCKSGTMSRSRSGKLHGLSGRLRVGALSQ
LRTEHKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTTSTRTTTTPFPTIHLRSSPSL
PPASPCPALAFWKRVRIGLEDIWNSLSSVFTEMQPIDRNQR
Download sequence
Identical sequences Q9BUN1
NP_060330.2.87134 NP_060330.2.92137 gi|20149646|ref|NP_060330.2| ENSP00000357922 ENSP00000357922 9606.ENSP00000357922 1029 ENSP00000357922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]