SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9BYD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BYD9
Domain Number 1 Region: 145-372
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.91e-76
Family Actin/HSP70 0.000000318
Further Details:      
 
Domain Number 2 Region: 7-152
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.5e-47
Family Actin/HSP70 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9BYD9
Sequence length 372
Comment (sp|Q9BYD9|ACTT3_HUMAN) Actin-related protein M1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ACTRT3; OC=Catarrhini; Hominidae; Homo.
Sequence
MNHCQLPVVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDW
RSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITE
MFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLA
GLDLTNYLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCLEKVYQLP
DGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIMKCDTGLRNSFFSNIILAGGS
TSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQDMWITAAEFK
EVGPNIVHQRCF
Download sequence
Identical sequences Q9BYD9
ENSP00000333037 ENSP00000333037 9606.ENSP00000333037 NP_115876.3.87134 NP_115876.3.92137 ENSP00000333037 gi|221139714|ref|NP_115876.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]