SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9BZ23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BZ23
Domain Number 1 Region: 330-350,381-565
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.37e-74
Family Fumble-like 0.0000000419
Further Details:      
 
Domain Number 2 Region: 211-355
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.93e-47
Family Fumble-like 0.000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9BZ23
Sequence length 570
Comment (sp|Q9BZ23|PANK2_HUMAN) Pantothenic acid kinase 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PANK2; OC=Catarrhini; Hominidae; Homo.
Sequence
MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRV
REPTGREAFGPSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRL
LLRMGGGRLGAPMERHGRASATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAE
GTRRDRLGSYSGPTSVSRQRVESLRKKRPLFPWFGLDIGGTLVKLVYFEPKDITAEEEEE
EVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKGNLHFIRFPTHDMPAFIQMGR
DKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDSVGFNGRSQC
YYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG
LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK
REAVSKEDLARATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDY
WSKGQLKALFSEHEGYFGAVGALLELLKIP
Download sequence
Identical sequences Q9BZ23
ENSP00000313377 9606.ENSP00000313377 ENSP00000417609 ENSP00000313377 ENSP00000480963 gi|85838513|ref|NP_705902.2| NP_705902.2.87134 NP_705902.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]