SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9C7G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9C7G6
Domain Number 1 Region: 72-254
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000833
Family N-acetyl transferase, NAT 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9C7G6
Sequence length 256
Comment (tr|Q9C7G6|Q9C7G6_ARATH) Acyl-CoA N-acyltransferases (NAT) superfamily protein {ECO:0000313|EMBL:AEE35265.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F28P5.8 OC=Arabidopsis.
Sequence
MGHLPQSLYSAAGPKFPYPGSSGLGVDQRKLTWSRFPVFLRCASTESLTSLTQNNAAEIE
LKYLVSQHGWDVRRLNRDDEDEIRRVSLVQAEAFHIPLALFDDFFFMFFQAEVLSALLYK
LKNSPPDRYACLVAEQTSETETLSSSSVVGVVDVTAQTESSVLRYFPGVEEYLYVSGLAV
SKSQRRKKMASTLLKACDVLCYLWGFKLLALRAYEDDAAARNLYSNAGYSVVETDPLWTS
TWIGRKRRVLMSKRFS
Download sequence
Identical sequences Q9C7G6
AT1G72030.1 NP_177348.1.80155 AT1G72030.1 3702.AT1G72030.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]