SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9CJQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9CJQ0
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.73e-37
Family ArsC-like 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9CJQ0
Sequence length 134
Comment (tr|Q9CJQ0|Q9CJQ0_PASMU) Arsenate reductase {ECO:0000256|RuleBase:RU362029} KW=Complete proteome; Reference proteome OX=272843 OS=Pasteurella multocida (strain Pm70). GN=PM1944 OC=Pasteurellaceae; Pasteurella.
Sequence
MNITIYHNSNCGTSRNVLALIRHAGIEPQVIEYLKNPPSETTLRNLIKRMGITPRQLLRT
NVVPYETLGLQNEKLSDDELISAMLREPILINRPIVVSEKGVKLCRPSETVLAFLPPFAI
PFVKEDGEIINHKE
Download sequence
Identical sequences Q9CJQ0
272843.PM1944 gi|15603809|ref|NP_246883.1| WP_010907414.1.12311 WP_010907414.1.15732 WP_010907414.1.19996 WP_010907414.1.40210 WP_010907414.1.45422 WP_010907414.1.4808 WP_010907414.1.53852 WP_010907414.1.6219 WP_010907414.1.62389 WP_010907414.1.66990 WP_010907414.1.81885 WP_010907414.1.8281 WP_010907414.1.89773 WP_010907414.1.9746 WP_010907414.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]