SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9CP63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9CP63
Domain Number 1 Region: 36-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.43e-24
Family DsbA-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9CP63
Sequence length 224
Comment (tr|Q9CP63|Q9CP63_PASMU) Uncharacterized protein {ECO:0000313|EMBL:AAK02277.1} KW=Complete proteome; Reference proteome OX=272843 OS=Pasteurella multocida (strain Pm70). GN=PM0193 OC=Pasteurellaceae; Pasteurella.
Sequence
MTMWRIGSLFLFVWSVAQCALATPISVSSYSDKSPLFLEGRDYFSYQEPVYQANPSEPIL
IQFFFDYDCRVCSSALDILELYSQINFDKVVLKELPIAAEKAHYSALIFYALKEIQAEDI
SALLLFETADKHRYGQLSRFHDLRLWLDGQGVNTDDFTKALYSVKVAKAVEQAEKLTEEY
GVFTFPYVVIDGRYVLTASTLYSDDYSFAVLDFLVSKLMKEKQK
Download sequence
Identical sequences Q9CP63
272843.PM0193 gi|15602058|ref|NP_245130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]