SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9CR55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9CR55
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00188
Family AN1-like Zinc finger 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9CR55
Sequence length 154
Comment (sp|Q9CR55|CP087_MOUSE) UPF0547 protein C16orf87 homolog KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN= OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSATRAKKVKMATKSCPECDQQIPVACKSCPCGYIFISRKLLNAKHSEKSPPSTENKHEA
KRRRTERVRREKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSSSAKKHEEEREKQEK
EIDIYANLSDEKAFVFSVALAEINRKIINQRLIL
Download sequence
Identical sequences B2RZC8 Q9CR55
ENSMUSP00000040975 NP_001127893.1.100692 NP_001127893.1.4139 NP_079998.1.92730 ENSRNOP00000023169 ENSRNOP00000023169 ENSMUSP00000040975 10090.ENSMUSP00000040975 10116.ENSRNOP00000023169 ENSMUSP00000040975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]