SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9CWY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9CWY8
Domain Number 1 Region: 29-248
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.71e-58
Family Ribonuclease H 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9CWY8
Sequence length 301
Comment (sp|Q9CWY8|RNH2A_MOUSE) Ribonuclease HI subunit A KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rnaseh2a; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADL
EALKVADSKTLTENERERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHD
TAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAAS
IFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWS
TAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAPHRYFQERGLEAASS
L
Download sequence
Identical sequences Q9CWY8
ENSMUSP00000105358 ENSMUSP00000105360 ENSMUSP00000120374 10090.ENSMUSP00000105360 NP_081463.1.92730 XP_011246799.1.92730 XP_011246800.1.92730 400104 3kio_A 3p5j_A ENSMUSP00000066769 ENSMUSP00000105358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]