SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9CZI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9CZI9
Domain Number 1 Region: 109-271
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-34
Family DnaQ-like 3'-5' exonuclease 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9CZI9
Sequence length 336
Comment (sp|Q9CZI9|AEN_MOUSE) Interferon-stimulated 20 kDa exonuclease-like 1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Aen; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVAGEVPESTQCPSLTSLNTKDVVRRRHKRRSRQHQRFMARKALLQEQELLSTAPGPGLC
LLPSPSQMPAVTEASDSRRQRPKARSGSNGLCSKKSVPREAPRPGPIKCVAIDCEMVGTG
PQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGITRQHMHKAIPFQVAQKEI
LKLLKGKVVVGHALHNDFQALKYVHPRSQTRDTTYVPNLLSQPSSLIRTRVSLKDLALNL
LHKKIQVGHQGHSSVEDAMTAMELYQLVEVQWEQQVASSAQAPAEDRGPDSSTDVEQYMD
DQYWPEDLTQSTGAETNGGPDRQEGEEGQGARSAPP
Download sequence
Identical sequences Q9CZI9
ENSMUSP00000103046 ENSMUSP00000103048 ENSMUSP00000103046 ENSMUSP00000103044 NP_080807.3.92730 XP_006541200.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]