SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9D1E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9D1E6
Domain Number 1 Region: 96-233
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.75e-40
Family Cap-Gly domain 0.00000623
Further Details:      
 
Domain Number 2 Region: 9-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.32e-27
Family Ubiquitin-related 0.00000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9D1E6
Sequence length 244
Comment (sp|Q9D1E6|TBCB_MOUSE) Tubulin-specific chaperone B KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Tbcb; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEVTGISAPTVMVFISSSLNSFRSEKRYSRSLTIAEFKCKLELVVGSPASCMELELYGAD
DKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGVRLGEYEDVSKVEKYEISPEAYERRQNT
VRSFMKRSKLGPYNEELRAQQEAEAAQRLSEEKAQASAISVGSRCEVRAPDHSLRRGTVM
YVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSAVTVGDFPEEDYG
LDEM
Download sequence
Identical sequences Q9D1E6
NP_079824.2.92730 10090.ENSMUSP00000006254 ENSMUSP00000006254 ENSMUSP00000006254 ENSMUSP00000006254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]