SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9D1G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9D1G0
Domain Number 1 Region: 22-276
Classification Level Classification E-value
Superfamily DNase I-like 4.71e-40
Family DNase I-like 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9D1G0
Sequence length 278
Comment (sp|Q9D1G0|DNSL2_MOUSE) Deoxyribonuclease I-like 2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Dnase1l2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MGWPWAPLTAVWALGVMGATALRIGAFNVQSFGDNKVSDPDCGSVIAQILAGYDIALVQE
VRDPDLSAVSLLMEQINRVSKHEYGFVSSKPLGRDQYKEMYLFVYRKDVASVVSTYQYPD
PEDAFSREPFVVKFSVPSCATKELVLIPLHAAPHQAVAEIDALYDVYLDVIDKWNTDDML
FLGDFNADCKYVKAHDWPSIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVVSGAHLRRS
LKPHSASVHNFQEEFDLDQTQALAISDHFPVEVTFKTH
Download sequence
Identical sequences Q9D1G0
NP_079994.2.92730 ENSMUSP00000085862 10090.ENSMUSP00000085862 ENSMUSP00000085862 ENSMUSP00000085862 ENSMUSP00000113508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]