SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9D9D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9D9D8
Domain Number 1 Region: 18-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.98e-39
Family Dual specificity phosphatase-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9D9D8
Sequence length 189
Comment (sp|Q9D9D8|DUS21_MOUSE) Dual specificity phosphatase 21 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Dusp21; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTTASCIFPSQATQQDNIYGLSQITASLFISNSAVANDKLTLSNNHITTIINVSAEVVNT
FFEDIQYVQVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVSRSATLCLAYL
MKYHNMTLLDAHTWTKTCRPIIRPNNGFWEQLIHYEFKLFSRNTVRMIYSPIGLIPNIYE
KEAYLMELM
Download sequence
Identical sequences Q9D9D8
NP_082844.1.92730 ENSMUSP00000026018 10090.ENSMUSP00000026018 ENSMUSP00000026018 ENSMUSP00000026018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]