SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9DAW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9DAW9
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-47
Family Calponin-homology domain, CH-domain 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9DAW9
Sequence length 330
Comment (sp|Q9DAW9|CNN3_MOUSE) Calponin, acidic isoform KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Cnn3; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDQQAEEDLRNWIEEVTGLGIGTNFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYPDDYPREYQYGDDQGIDY
Download sequence
Identical sequences Q9DAW9
NP_082320.1.92730 10090.ENSMUSP00000029773 ENSMUSP00000029773 ENSMUSP00000029773 ENSMUSP00000029773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]