SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9DCN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9DCN1
Domain Number 1 Region: 264-456
Classification Level Classification E-value
Superfamily Nudix 1.49e-45
Family NADH pyrophosphatase 0.001
Further Details:      
 
Domain Number 2 Region: 14-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-19
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9DCN1
Sequence length 462
Comment (sp|Q9DCN1|NUD12_MOUSE) Nucleoside diphosphate-linked moiety X motif 12 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Nudt12; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSSVKRNPKKEMISELHSSAAEGNVAKLAGILSHSPSLLNETSENGWTALMYAARNGHPD
VVQFLLEKGCDRSLVNKARQTALDIAAFWGYRHIANLLANAKGGKKPWFLTNEVDECENY
FSRTLLDRRSDKRNNSDWLQAKESHPTTVYLLFSDLNPLVTLGGNKESSQQPEVRLCQLN
YPDVKGYLAQPEKITLVFLGVELEMRKGSPAQAGGVPEEEEDGLVAWFALGIEPGAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGSATKIEEGGYKR
VCVRETCPSLQGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDAR
WFTREQVVDVLTKGKQQAFFVPPSRAIAHQLIKHWVGMNPNL
Download sequence
Identical sequences Q9DCN1
ENSMUSP00000025065 ENSMUSP00000025065 10090.ENSMUSP00000025065 NP_080773.1.92730 ENSMUSP00000025065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]