SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9EPD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9EPD4
Domain Number 1 Region: 62-255
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.26e-23
Family YdeN-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9EPD4
Sequence length 268
Comment (tr|Q9EPD4|Q9EPD4_NEOFU) Lecithin cholesterol acyl transferase {ECO:0000313|EMBL:CAC18124.1} OX=105199 OS=Neotoma fuscipes (Dusky-footed woodrat). GN=lcat OC=Muroidea; Cricetidae; Neotominae; Neotoma.
Sequence
XFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDDNK
LAYMHTLVQNLVNNGYVRDETVRAAPYDWRLEPQQDEYYQKLAGLVEEMYAAYGKPVFLI
GHSLGCLHVLYFLREKQRITTTSPWMFPAHQVWPEDHVFISTPNFNYTGQDFKRFFSDLH
FEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPHTYIYDHSFPYKDPVAALYEDGDD
TVATRSTELCGRWQGRQSQPVHLLPMNG
Download sequence
Identical sequences Q9EPD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]