SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9ER72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9ER72
Domain Number 1 Region: 112-189,289-355,390-535
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.92e-85
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000638
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000159
Family Glutathione S-transferase (GST), C-terminal domain 0.036
Further Details:      
 
Domain Number 3 Region: 570-717
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000000019
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9ER72
Sequence length 831
Comment (sp|Q9ER72|SYCC_MOUSE) Cysteinyl-tRNA synthetase KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Cars; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAGSSAEQAADYRSILSISDEAARVQALDQHLSTRSYIQGYSLSQADVDVFRQLSAPPAD
SRLFHVARWFRHIEALLGGPQGRDEPCRLQASKGRRVQPQWSPPAGTEPCRLRLYNSLTR
NKDVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLRDYFQYDVFYCMNITD
IDDKIIRRARQNYLFEQYREQKPPATQLLKDVRDAMKPFSVKLSETTDPDKRQMLERIQN
SVKLATEPLEQAVRSSLSGEEVDSKVQVLLEEAKDLLSDWLDSTGGSEVTDNSIFSKLPK
FWEEEFHKDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYASNGSVYFDTAKFAA
SEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPW
GKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHT
GHLTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEK
FMNEFFLNVKDILRAPVDITGQFEKWEAEEVELNKNFYGKKTAVHEALCDNIDTRTVMEE
MRALVSQCNLYMAARKAERRRPNRALLENIAMYLTHMLKIFGAIEEESPLGFPVGGPGTN
LNLESTVMPYLQVLSEFREGVRKIAREKKVLEVLQLSDALRDDILPELGVRFEDHEGLPT
VVKLVDRDTLLKEKEGKKRAEEEKRRKKEEAARKKQEQEAAKLAKMKIPPSEMFLSEVNK
YSKFDENGLPTHDTEGKELSKGQAKKLKKLFEAQEKLYKEYLQMLQNGSLQ
Download sequence
Identical sequences Q9ER72
ENSMUSP00000010899 NP_038770.3.92730 10090.ENSMUSP00000010899 ENSMUSP00000010899 ENSMUSP00000010899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]