SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9FJT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9FJT8
Domain Number 1 Region: 23-363
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.19e-71
Family N-acetyl transferase, NAT 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9FJT8
Sequence length 467
Comment (sp|Q9FJT8|HATB_ARATH) Histone acetyltransferase type B catalytic subunit KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=MIK19.19; OC=Arabidopsis.
Sequence
MVQKQQASAGPGTEPKKRRRVGFSPADTGVEANECIKIYLVSSKEEVDSSDISSVKPVDL
NDFFDGDGKIYGYQGLKINVWINSISLHSYADITYQSTINGDKGITDLKSALQNIFAETI
VDTKDEFLQTFSTQRDFIRNMVSNGEVMHAGATDGSSKNAEVVPSDPQVIRMEIGSPNAG
LLYSRLVPLVLLFVDGSNPIDVTDPDWHLYLLIQKKEEKEDPLYRIVGFTAIYKFYRYPD
RLRMRLSQILVLPSFQGKGLGSYLMEVVNNVAITENVYDLTVEEPSEKFQHIRTCIDINR
LRSFDPIKPDIDSAVQTLTKGKLSKKAQIPRFTPPLNAIEKVRESLKINKKQFLKCWEIL
IYLALDPIDKYMEDYTSVITNHVRTDILGKDIETPKKQVVDVPSSFEPEASFVVFKSVNG
EEANTNVQVDENKPDQEQQLKQLVEERIREIKLVAEKVSKSGQTLKV
Download sequence
Identical sequences Q1JPN3 Q9FJT8
NP_200485.1.80155 3702.AT5G56740.1-P AT5G56740.1 AT5G56740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]