SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9GQ82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9GQ82
Domain Number 1 Region: 628-771
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00000000000000157
Family Type II Proline 3-hydroxylase (proline oxidase) 0.064
Further Details:      
 
Domain Number 2 Region: 457-581
Classification Level Classification E-value
Superfamily TPR-like 0.000000000228
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Weak hits

Sequence:  Q9GQ82
Domain Number - Region: 367-496
Classification Level Classification E-value
Superfamily TPR-like 0.000417
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9GQ82
Sequence length 785
Comment (tr|Q9GQ82|Q9GQ82_DROME) Aspartyl beta-hydroxylase, isoform A {ECO:0000313|EMBL:AAM70947.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG8421 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSGDVQPRKRKDKRRKRDDDESSHGVHITKMGNEDLHLHVHHDHGTGGHWCAKIIFFALM
AVLLGLVGLIIMENRGLEDLDTPLSESRFSKVFDGWVDEHRDEHDGHDVQEPSGEALDDH
DEHDDHDDHEDEDEEPLTEELEEELEEEEEPTEEDEPAADEEYEEDEDEENNAGENITAE
DAEEEEEEEDNDDEGTVEATVEATTEATTEATGEYEAEEDDEDEAAADDDAVESTEAPLS
KAEEQEDDEDEDEEEQEIEESVEPERSQYAAQSAPAKDNNDDDDDDDQDKNDADDGDDDE
FESLAQQFENDPEDTVPAKAVESEEQDQDQADEEEPKEEGSSWLASQIKPKEAAPAPAEK
EDPFEQELRKANEEMIRENYAQALRSFNTLTTNFAHEPSAHLGRARLLELLAKKERSNQR
LWEAIDAYKRYLAFGELVASNQEFQTAGESCIENLRFLGHHRQATTIHELLINRLPEDPR
LRNQLSLTYLMVNNLQQVEKVAVETLKLWPNNAVAQLHYGLALRQFHADYAKALPYLKYA
VESGEEGTQEAFFYLSLGETMQRLSMKSEALEVYGKGVAKGFFASLYQRSLYNEPRLRAQ
PFWQPKETGYERQLEKLTLNWRAIRDEGLALLGRSGFFEDEAELLRDKGVWQQYELYAQG
RRVKDNCRRAPITCSLLEEFPESAGCRRGQVKFSVMQAKTHVWPHCGPTNCRLRAHLTLA
APEPEKASLRVAEQERTWREGELFIFDDSFEHEVWHNGSQSRLVLILDMWHPQLSAAQRR
SLSPI
Download sequence
Identical sequences Q9GQ82
NP_725525.1.81976 FBpp0086359 FR293 FBpp0086359 7227.FBpp0086359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]