SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9GQP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9GQP3
Domain Number 1 Region: 2-283
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-67
Family Duffy binding domain 0.0000000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9GQP3
Sequence length 503
Comment (tr|Q9GQP3|Q9GQP3_PLAVI) Duffy binding protein {ECO:0000313|EMBL:AAG43990.1} OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=DBP OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
ERDWDCNTKKDVCIPDRRYQLCMKELTNLVNNTDTNFHRDITFRKLYLKRKLIYDAAVEG
DLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQ
RRKQWWNESKAQIWTAMMYSVKKRLKGKFIWICKINVAVNIEPQIYRRIREWGRDYVSEL
PTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFKSVKNAE
KVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCSVEEAKKNTQEVVTNVD
NAAKSQATNSNPISQPVDSSKAEKVPGDSTHGNVNSGQDSSTTGKAVTGDGQNGNQTPAE
SDVQRSDIAESVSAKNVDPQKSVSKRSDDTASVTGIAEAGKENLGASNSRPSESTVEANS
PGDDTVNSASIPVVSGENPLVTPYNGLRHSKDNSDSDGPAESMANPDSNSKGETGKGQDN
DMAKATKDSSNSSDGTSSATGDT
Download sequence
Identical sequences Q9GQP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]