SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9GQP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9GQP4
Domain Number 1 Region: 2-283
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-68
Family Duffy binding domain 0.00000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9GQP4
Sequence length 510
Comment (tr|Q9GQP4|Q9GQP4_PLAVI) Duffy binding protein {ECO:0000313|EMBL:AAG43989.1} OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=DBP OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
ERDWDCNTKKDVCIPDRRYQLCMKELTNLVNNTDTNFHRDITFRKLYLKRKLIYDAAVEG
DLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSEVVENNLRSIFGTGEKAQQ
HRKQWWNESKAQIWTAMMYSVKKRLKGKFIWICKINVAVNIEPQIYRRIREWGRDYVSEL
PTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFKSVKNAE
KVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCSVEEAKKNTQEVVTNVD
NAAKSQATNSNPISQPVDSSKAEKVPGDSTHGNVNSGQDSSTTGKAVTGDGQNGNQTPAE
SDVQRSDIAESVSAKNVDPQKSVSKRSDDTASVTGIAEAGKENLGASNSRPSESTVEANS
PGDDTVNSASIPVVSGENPLVTPYNGLRHSKDNSDGPAEFAESTKSAESMANPDSNSKGE
TGKGQDNDMAKATKDSSNSSDGTSSATGDT
Download sequence
Identical sequences Q9GQP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]