SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9GT78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9GT78
Domain Number 1 Region: 612-963
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-79
Family Duffy binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 2-294
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-57
Family Duffy binding domain 0.00059
Further Details:      
 
Domain Number 3 Region: 1046-1245
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-52
Family Duffy binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 286-483
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.28e-26
Family Duffy binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9GT78
Sequence length 1307
Comment (tr|Q9GT78|Q9GT78_PLAFA) VarP {ECO:0000313|EMBL:AAG29983.2} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=varP OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
ARSFADIGDIIRGKDLYRGGGRGRKQLEENLQKIFGNIYNELTTSGKNVDKAKERYKGDA
DNNYFQLREDWWDANRHTVWEAITCKAEQNNKYFRDACSTGTPTHEKCRCVNRADVPTYF
DYVPQYLRWFEEWAEDFCRKRNIKLKSAKNACRNESKQLYCSHNGYDCTKRIEKGKSCSR
DSKCTECSTKCIPYEYWLEKQQNEFNMQKDKYDKEIRTKTSNNGISNSNINNKYYKEFYN
ELNKKYESVENFLTLLNNGMYCKKRVEGKYVINFTKTADKDAFDRSEYCQPCPDCVVQCD
GKRCAEDTKDNNCRSKIIEEILQSEETTDIYVLYSGKGPGAITKKLHDFCSNTNKEDRKY
YKKWKCYNKNKDYNNCEMNISSYKDATDPNVMLSVECFHSWAKNLLIDTIRWEHQLKNCI
NNTNVTDCKSKCNSNCQCYEKWIKEKEKEWPQVKGVLKKKDETSHNYYDKLKDVFDRFLF
EVKGALDQDEKGKWDQFTKDLEKKFGPSVESAGTANSQDAIELLLDHLNDNAITCKDNNS
LKEDKNCPKTKINPCIKGTCKRTGGASNNLVSVKHIAEIMQQDAREQLEKRGGESNLKGD
ASKGTYGQGGHGDVFKDVCNITASHSNATTTFSKGPCYGKDKVINGVRMKIGNRWTHLQN
AKTTYSDVFLPPRRQHMCTSNLEYLQTKDGPLNGMEIVKNGKNGKLVNNSFLGDVLLSAK
MDAGKIIELYKKQNNKSNLTDPEDNESACRALRYSFADIADIIRGRDMWDKDDGAQKMDV
ILKNVFGTLHKSLEGIRNHPKYAYDKTKTSPYKQLREDWWEANRHQVWRAMKCATKAIPD
MKCNGIPIEDYIPQRLRWMTEWAEWFCKMQSQEYEKLEKECGGCKEMGGQCTNDTEDCQR
CTQACEEYKKKIEPWEKQWTKIKDKYKTLYEQATKNGETSGTPNEKDKDVVDFLKQLLAQ
NSAAARNRVIRAAGNSATRVIATTAPNTPYATAAGYIHQELQNMECQVQKEFCEKKRGDK
KKYAFRHQPYDYDDALRCDSRTAPEPKKVEKKEVLDVCGVVKGVLSKPRNKKGGIDGCNP
KKDYPSWHCNKKESMAENSGACIPPRRRKLCVSSLTKQYRIKAIEDIRTEFINCAAIETY
FAWERYKKDNKKAEDELKSGTIPHEFKRQMYYTFGDYRDIFFGTDISTHAHISDVSPNVI
TILEKENGTKSEGKQKSKNELLDDWWDEHGHEIWEGMLCALTYKDKTSGSGGEGKTTITQ
DESLKEALWDEASNKPKNHDYNSVTISSVGPSGEKTYLSKFAERPQF
Download sequence
Identical sequences Q9GT78

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]