SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9HAK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HAK2
Domain Number 1 Region: 253-336
Classification Level Classification E-value
Superfamily E set domains 5.6e-20
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Weak hits

Sequence:  Q9HAK2
Domain Number - Region: 343-390
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0785
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9HAK2
Sequence length 575
Comment (sp|Q9HAK2|COE2_HUMAN) Early B-cell factor 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EBF2; OC=Catarrhini; Hominidae; Homo.
Sequence
MFGIQDTLGRGPTLKEKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSN
LRKSNFFHFVLALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVR
TEQDLYVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPV
IIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHG
RRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGDNFFDGLQVVFGTMLVWSELITPHA
IRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRLQKVIPRHPGD
PERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNPSQLPALSSSPA
HSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMN
GYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKS
AFAPVIRPQGSPSPACSSGNGNGFRAMTGLVVPPM
Download sequence
Identical sequences Q9HAK2
gi|113930703|ref|NP_073150.2| ENSP00000386178 NP_073150.2.87134 NP_073150.2.92137 ENSP00000430241 ENSP00000430241 9606.ENSP00000386178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]