SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9HB29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HB29
Domain Number 1 Region: 373-537
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.28e-23
Family Toll/Interleukin receptor TIR domain 0.0041
Further Details:      
 
Domain Number 2 Region: 27-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000734
Family I set domains 0.0079
Further Details:      
 
Domain Number 3 Region: 134-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000934
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 229-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000135
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9HB29
Sequence length 575
Comment (sp|Q9HB29|ILRL2_HUMAN) Interleukin-1 receptor-related protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IL1RL2; OC=Catarrhini; Hominidae; Homo.
Sequence
MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNS
SKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDT
SIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRL
LVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQ
LGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVVYIYNIFK
IDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDG
MKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRR
CRPFPPVQLLQHTPCYRTAGPELGSRRKKCTLTTG
Download sequence
Identical sequences Q9HB29
ENSP00000264257 NP_003845.2.87134 NP_003845.2.92137 XP_005264093.1.92137 9606.ENSP00000264257 ENSP00000264257 NYSGRC-IgSF-ILRL2_HUMAN gi|28416902|ref|NP_003845.2| ENSP00000264257 ENSP00000442184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]