SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9HZ91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HZ91
Domain Number 1 Region: 78-179
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.42e-25
Family Tetracyclin repressor-like, C-terminal domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 5-63
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000296
Family Tetracyclin repressor-like, N-terminal domain 0.0000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9HZ91
Sequence length 180
Comment (tr|Q9HZ91|Q9HZ91_PSEAE) Probable transcriptional regulator {ECO:0000313|EMBL:AAG06521.1} KW=Complete proteome; Reference proteome OX=208964 OS=JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1). GN=PA3133 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSDKKTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEAFE
QLLGKRRELLGELDPGLSGKERRALAAAFYLSRKHRDAQVDAGCPLPATLAEVARLPEGF
REVLSRHVEIMVTSLAESPEETDVALADLVLMIGGLALARALGPGELSDRVLRAAKQAVN
Download sequence
Identical sequences Q9HZ91
APC5936 208964.PA3133 2fd5_A NP_251823.1.87394 WP_003115025.1.18653 WP_003115025.1.24879 WP_003115025.1.35480 WP_003115025.1.41773 WP_003115025.1.48413 WP_003115025.1.50653 WP_003115025.1.55347 WP_003115025.1.62357 WP_003115025.1.65066 WP_003115025.1.73455 WP_003115025.1.7408 WP_003115025.1.81771 WP_003115025.1.84715 WP_003115025.1.90141 WP_003115025.1.92175 WP_003115025.1.98600 gi|15598329|ref|NP_251823.1| 2fd5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]