SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9LFN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9LFN7
Domain Number 1 Region: 6-64
Classification Level Classification E-value
Superfamily DNA-binding domain 5.89e-20
Family GCC-box binding domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9LFN7
Sequence length 189
Comment (sp|Q9LFN7|SHN2_ARATH) Ethylene-responsive transcription factor SHINE 2 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F2I11.80; OC=Arabidopsis.
Sequence
MVHSRKFRGVRQRQWGSWVSEIRHPLLKRRVWLGTFETAEAAARAYDQAALLMNGQNAKT
NFPVVKSEEGSDHVKDVNSPLMSPKSLSELLNAKLRKSCKDLTPSLTCLRLDTDSSHIGV
WQKRAGSKTSPTWVMRLELGNVVNESAVDLGLTTMNKQNVEKEEEEEEAIISDEDQLAME
MIEELLNWS
Download sequence
Identical sequences Q9LFN7
3702.AT5G11190.1-P AT5G11190.1 NP_196680.1.80155 AT5G11190.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]