SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9N4Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9N4Z2
Domain Number - Region: 176-223
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9N4Z2
Sequence length 301
Comment (tr|Q9N4Z2|Q9N4Z2_CAEEL) Uncharacterized protein {ECO:0000313|EMBL:CCD71150.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_Y42G9A.1 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MDDSQESSFSVSKYETNDDGSMGQFISINECEREIQMLERDIRQQKESSANAKTAITFDQ
LRKIHTLSTLLGPHKELFFDRICRAADIQRASLKNRLKSNINKFEPSTPLSFQPGFDSQS
SLSTTSESQNFVVTPTTLSSLLNNHTRKNHIEMLAPLASEEELMRFPAERQFDLMQIGFS
YDEVKQLLEMFEKFKNDVQEINRLHTLTQILNQFCNYISMYAPPNLKMISSAFNLLELGN
SAHEVKRVLLKARRREESEESDVSFSKKPRPSSRSPASPNRDDLLLGLDRSPPSDDGTQK
V
Download sequence
Identical sequences Q9N4Z2
6239.Y42G9A.1 Y42G9A.1 Y42G9A.1 Y42G9A.1 Y42G9A.1 NP_498333.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]