SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9N9G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9N9G9
Domain Number 1 Region: 426-726
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.76e-63
Family Duffy binding domain 0.000000000104
Further Details:      
 
Domain Number 2 Region: 145-395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-54
Family Duffy binding domain 0.00000000047
Further Details:      
 
Weak hits

Sequence:  Q9N9G9
Domain Number - Region: 63-102
Classification Level Classification E-value
Superfamily Cullin homology domain 0.0811
Family Cullin homology domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9N9G9
Sequence length 1433
Comment (tr|Q9N9G9|Q9N9G9_PLARE) Erythrocyte binding protein {ECO:0000313|EMBL:CAB96159.1} OX=5854 OS=Plasmodium reichenowi. GN=EBP OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
SFFVLYFAKARNEYDIKENEKFLEVYKEKFNELDKKKYGNVQKTDKKIFSFIENKLDILN
NSKSNKRWKSYGTPDNIDKNMSLINKYNNKETFNNNYQSFLSTSSLIKQNRYVPINAVRV
SRILSFLDSKINNGRNTSSNDGDLRNCREKRKGNEWDCKKKNGTSNYVCIPDRRIQLCIV
NLSIIKTYTKETMKDHFIEASRRESQLLLKKNDNNYNSKFCNDLKNSFLDYGHLAMGNDM
DFGGYSTKAENKIQEVFKGVHGKISEHEIKNFRKKWWNEFREKLWEAMISEHKNNLSDCK
NIPEEELQINQWIKEWHGEFLSERNNRLKLPKSKCKNNTLYEACAKECIDPCMKYRDWII
KSKFEWHTLSKEYERKNVSNKDAEKYLIKFSKNNDAKVSLLLDKCDAEYSKYCDCKHTTT
LVKSVLNGKDNTSKEERETIDLDDFSKFGCDKNSVDTNRKEWECKKPYILSTKDVCVPPR
RQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDNEVCNVINKSFADIRD
IIKGSDYWNDLSNRKLVGKINTNSKYVHKNKENDKLFRDEWWNVIKKDVWNVMSWVFKDK
TVCKEDDIENIPQFFRWFSEWGDDYCQYKLKMIDTLKVACEEKGYDDITCKNKCSSYKDW
ISKQKYLYDKQVTIYKEYQRNNNRIYPIVKTMEPKVYLKEYSKKCSNINFEDEFNEEVHS
DYKNKCMISTKVLDVPIPAEKNVTEALETVVPKENTEIERKNESDTEEQKNQEIPNNYLK
DSQQRVGENGTKVSSQEDLRGSRNEEGVTQEFGLNDEIPKGEEQISGKSGVIQNRSESEM
GISTSEESRHEEGHNEQTLSTSVDQSELSDTLQSHEDTKENDELPLASSTITSPMESGSS
DTEETQSISEGPKGNEQKERDDDSSSKISVSPEISRTETHDKDTSNLLRLKEDVDISMPK
AVIGKDPNDHINNTAEGDHISGVNSSPLSDGVRPDKNHEEVKEHTSNPDNVQQSGENVNM
NVENQLKDTLENTSSSLGEGKAHEELSEPNLSSGQDMSNTPAPLDNTSEETTERISNNEY
KVNEREDERTLTKEYEDIVLKSHMNRESDDDELDGKNSDVPTVNDESEDVEEKMKRNDTS
EISEDSSQHIESDQQENDMKTVGDLGTIHVQNEINDSVTGENKEQTVHGDEGVRLSHKDK
HKINLEDKNSNILHLKDMRNEENERKQLANQNINISQQRDLQEHGFHTMNNLHGDGVSEG
SQINHGNPVKRQDRGKPSGNVLNMGSNNNNFHNIPSRYNLYDKKLNLDLYVNRNDSTTKE
LIKKLAEINKCENEISAKYCSDMIDKEIPLKTCTKEKTINLCCAVADYCLSYFTYDSKEY
SNCTKREFEDPSYTCFRKKGFSSMIFKFLITNKIYYYFYTYKNAKVTIKKINF
Download sequence
Identical sequences Q9N9G9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]