SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9ND04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9ND04
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-16
Family Duffy binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9ND04
Sequence length 70
Comment (tr|Q9ND04|Q9ND04_PLAFA) Variant surface protein {ECO:0000313|EMBL:AAF89800.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
PYRRLHVCDRNLELIKPKNITTHNLLADVCQAAKFEAESLKTYRAQYQDKYGDTVSPICT
VLARSFADIG
Download sequence
Identical sequences Q9ND04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]