SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9NHG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NHG8
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-26
Family Duffy binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NHG8
Sequence length 119
Comment (tr|Q9NHG8|Q9NHG8_PLAFA) PfEMP1 protein {ECO:0000313|EMBL:AAF36662.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIGDIIRGKDLYLGDRKEKVKLEENLKKIFKEIYGGLSNNVVKERYKKDDDNFYQLREDW
WNANRQEIWKAMTCSDRLGGNAYFRATCGSGKTPTQGKCRCEGANVVPTYFDYVPQYLR
Download sequence
Identical sequences Q9NHG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]