SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9NHM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NHM0
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.37e-28
Family Duffy binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NHM0
Sequence length 128
Comment (tr|Q9NHM0|Q9NHM0_PLAFA) PfEMP1 protein {ECO:0000313|EMBL:AAF36610.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIGDIVRGRDLYLGDKGEKEKLEEKLKKYFKKIHKEVTSGSNVKTLQARYKEDPNKNYYQ
LREDWWTANRETVWKAITCNDDNKLSNASYFRQTCGGDENTATEAKNKCRCNDNQVPTYF
DYVPQYLR
Download sequence
Identical sequences Q9NHM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]